LL-37
Also known as: ll37, cathelicidin, CAP-18, human cathelicidin antimicrobial peptide, CAMP
Human cathelicidin-derived antimicrobial peptide studied for broad-spectrum antimicrobial and immunomodulatory activity.
Quick Reference
LL-37 - Research Images
PSO vial render · Scientific images from Wikipedia · Tap to enlarge
Overview
Group of antimicrobial peptides in vertebrates
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa] In humans, CAMP encodes the peptide precursor CAP-18, which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37.
Mechanism of Action
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide
What Researchers Are Saying
Community Reports - Not Medical Advice
The following is aggregated from public forums, Reddit, and research communities. These are anecdotal reports from researchers only - not verified clinical data and not a recommendation of any kind.
LL-37 (also known as ll37, cathelicidin) is studied within the antimicrobial and infection research community. Human cathelicidin-derived antimicrobial peptide studied for broad-spectrum antimicrobial and immunomodulatory activity.
Last updated October 28, 2026
Research status: active. LL-37 appears across antimicrobial and infection research forums and academic literature. Researchers note this compound falls in the antimicrobial category.
Last updated October 28, 2026
What Do You Think of This Peptide?
Share your opinion or research experience with LL-37. Comments are reviewed before appearing.