SATPdb17393
Source record IDs: hipdb_HIP887
For in-vitro (laboratory) research purposes only. Not for human or animal consumption.
1What Is SATPdb17393?
SATPdb17393 is a 36-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as YTSLIHSLIEETQNQQEKNEQELLELDKWASLWNWF and classifies the record as: antiviral, antimicrobial. The record entered SATPdb from the hipdb database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.
2Amino Acid Sequence
YTSLIHSLIE ETQNQQEKNE QELLELDKWA SLWNWF
Verbatim sequence from the SATPdb record, one-letter amino acid code, N terminus to C terminus. 36 residues.
3Dataset Classification
SATPdb classifies this record as: antiviral, antimicrobial
Classification is the dataset grouping, recorded as a fact about the record.
4Source and Origin
SATPdb record ID: satpdb17393
Entered SATPdb from the database collection: hipdb
Dataset file: SATPdb dataset on GitHub · SATPdb web server
Data from SATPdb (https://github.com/raghavagps/SATPdb), Singh et al., Nucleic Acids Research 2016. Repo under MIT License; authors also state CC BY 4.0 for the article/data.
5Citation
Singh S, Chaudhary K, Dhanda SK, Bhalla S, Usmani SS, Gautam A, et al. SATPdb: a database of structurally annotated therapeutic peptides. Nucleic Acids Research. 2016;44(D1):D1119-D1126. doi:10.1093/nar/gkv1114
Fact page. Full research profile pending. All content on this page is for in-vitro research purposes only. Not intended for human or animal use. No content on this page constitutes medical advice or a treatment recommendation.
← Back to Peptide Library