Research Library

The Peptide Library

Scientific profiles for 5468 research compounds - mechanisms, history, vendor listings, lab purity data, and DisclosedLabs COAs. Refreshed from public research sources.

5468

Compounds

Check independent lab results, free

Finnrick Analytics publishes independent lab test results for peptide products from named vendors, and anyone can check the published results for free.

View published results on Finnrick How free lab results work

For in-vitro research use only. Not for human consumption.

Showing 301 to 350 of 5468 compounds · Page 7 of 110

SATPdb10283EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10283 is a 26-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as HRHQGPIFDTRPSPFNPNQPRPGPIY and classifies the record as: antibacterial, antimicrobial, antifungal. The record entered SATPdb from the apd2, camp, yadamp database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10284EmergingMetabolicFact page. Full research profile pending.

SATPdb10284 is a 5-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as IRRGQ and classifies the record as: antihypertensive. The record entered SATPdb from the ahtpdb database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10286EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10286 is a 15-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as PSRVEAFHRYGTTVN and classifies the record as: antiviral, antimicrobial. The record entered SATPdb from the avpdb database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10287EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10287 is a 31-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as LNLADATNFLQDSKAELEKARKILSEVGRWY and classifies the record as: antiviral, antimicrobial. The record entered SATPdb from the avpdb database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10288EmergingMetabolicFact page. Full research profile pending.

SATPdb10288 is a 6-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as EKDERF and classifies the record as: antihypertensive. The record entered SATPdb from the ahtpdb database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10290EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10290 is a 15-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as KWKLFKKAVLKVLTT and classifies the record as: antibacterial, antimicrobial. The record entered SATPdb from the camp, yadamp database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10301EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10301 is a 25-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as IKRFWPVVIRTVVAGYNLYRAIKKK and classifies the record as: antimicrobial. The record entered SATPdb from the yadamp database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10303EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10303 is a 8-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as TNWYGSGW and classifies the record as: antiviral, antimicrobial. The record entered SATPdb from the hipdb database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10304EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10304 is a 15-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as LKARTVTFGVVTSVI and classifies the record as: antiviral, antimicrobial. The record entered SATPdb from the hipdb database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10307EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10307 is a 16-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as MANAGLQLLGFILAFL and classifies the record as: antiviral, antimicrobial. The record entered SATPdb from the avpdb database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10309EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10309 is a 7-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as PFFHLIG and classifies the record as: antiviral, antimicrobial. The record entered SATPdb from the hipdb database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10311EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10311 is a 12-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as SWLRDIWDWICE and classifies the record as: antiviral, antimicrobial. The record entered SATPdb from the avpdb database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10313EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10313 is a 42-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as PPVYTKDVDISSQISSMNQSLQQSKDYIKEAQKILDTVNPSL and classifies the record as: antiviral, antimicrobial. The record entered SATPdb from the avpdb database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10317EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10317 is a 25-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as GIGAAILSAGKSIIKGLANGLAEHF and classifies the record as: antimicrobial. The record entered SATPdb from the yadamp database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10319EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10319 is a 8-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as WADWVRWI and classifies the record as: antiviral, antimicrobial. The record entered SATPdb from the avpdb database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10322EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10322 is a 50-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as VAGALGVQTAAATTIVNVILNAGTLVTVLGIIASIASGGAGTLMTIGWAT and classifies the record as: antimicrobial. The record entered SATPdb from the yadamp database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10326EmergingOtherFact page. Full research profile pending.

SATPdb10326 is a 5-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as APRPG and classifies the record as: drug delivery vehicle. The record entered SATPdb from the tumorhope database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10328EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10328 is a 33-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as LSELDDRADALQAGASQFETSAAKLKRKYWWKN and classifies the record as: antiviral, antimicrobial. The record entered SATPdb from the hipdb database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10331EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10331 is a 10-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as RRKKIFYFFR and classifies the record as: antiviral, antimicrobial. The record entered SATPdb from the avpdb database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10332EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10332 is a 37-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as VFIDILDKMENAIHKAAQAGIGIAKPIENMILPKLTK and classifies the record as: antimicrobial. The record entered SATPdb from the yadamp database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10336EmergingOtherFact page. Full research profile pending.

SATPdb10336 is a 33-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ and classifies the record as: cell-cell communication. The record entered SATPdb from the neuropedia database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10339EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10339 is a 13-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as ILPFLAGLFSKIL and classifies the record as: antimicrobial. The record entered SATPdb from the dadp database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10343EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10343 is a 13-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as KKKKVVAALYVLV and classifies the record as: antiviral, antimicrobial. The record entered SATPdb from the avpdb database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10344EmergingMetabolicFact page. Full research profile pending.

SATPdb10344 is a 5-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as PSSNK and classifies the record as: antihypertensive. The record entered SATPdb from the ahtpdb database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10351EmergingOtherFact page. Full research profile pending.

SATPdb10351 is a 14-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as NLYQFKEMIRYTIP and classifies the record as: toxic. The record entered SATPdb from the toxinpred database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10357EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10357 is a 10-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as GLLKRIKTLL and classifies the record as: antiparasitic, antimicrobial. The record entered SATPdb from the parapep, yadamp database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10360EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10360 is a 18-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as GIKYFSMVGNWAKVLVVL and classifies the record as: antiviral, antimicrobial. The record entered SATPdb from the avpdb database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10366EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10366 is a 17-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as SDFRRQNRRGGTNKRTT and classifies the record as: antiviral, antimicrobial. The record entered SATPdb from the avpdb database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10368EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10368 is a 15-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as YADHTGLVRDNMAKL and classifies the record as: antiviral, antimicrobial. The record entered SATPdb from the avpdb database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10375EmergingOtherFact page. Full research profile pending.

SATPdb10375 is a 27-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as TLQMLGTNAAAQAGNCAASGMMGGKGK and classifies the record as: miscellaneous. The record entered SATPdb from the conoserver database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10376EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10376 is a 28-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as RIILGQCIKREAEAAIEQIFRTKYNDSH and classifies the record as: antiviral, antimicrobial. The record entered SATPdb from the avpdb database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10378EmergingOtherFact page. Full research profile pending.

SATPdb10378 is a 35-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as AFGTILKALAKIAAKAVKKLATKPGATYMLKQNLE and classifies the record as: toxic. The record entered SATPdb from the toxinpred database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10380EmergingOtherFact page. Full research profile pending.

SATPdb10380 is a 14-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as GGWGQAGGWGKLFS and classifies the record as: miscellaneous. The record entered SATPdb from the conoserver database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10381EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10381 is a 34-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as SVALDPIDISIELNKAKSDLEESKEWIRRSNQKL and classifies the record as: antiviral, antimicrobial. The record entered SATPdb from the avpdb database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10382EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10382 is a 27-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as GIGGKILGGLKTALKGAAKELASTYLH and classifies the record as: antibacterial, antimicrobial, antifungal. The record entered SATPdb from the camp, yadamp database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10386EmergingOtherFact page. Full research profile pending.

SATPdb10386 is a 10-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as VSRSSRWGSI and classifies the record as: drug delivery vehicle. The record entered SATPdb from the tumorhope database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10389EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10389 is a 13-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as KIWFQNRRMKWKK and classifies the record as: antimicrobial. The record entered SATPdb from the yadamp database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10392EmergingOtherFact page. Full research profile pending.

SATPdb10392 is a 5-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as LPFEF and classifies the record as: cell-cell communication. The record entered SATPdb from the quorumpeps database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10393EmergingOtherFact page. Full research profile pending.

SATPdb10393 is a 5-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as GWMDF and classifies the record as: cell-cell communication. The record entered SATPdb from the neuropedia database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10395EmergingOtherFact page. Full research profile pending.

SATPdb10395 is a 7-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as SKSSGVS and classifies the record as: drug delivery vehicle. The record entered SATPdb from the tumorhope database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10397EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10397 is a 20-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as FIQYLAPLIPHAVKAISDLI and classifies the record as: antibacterial, antimicrobial. The record entered SATPdb from the camp database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10402EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10402 is a 19-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as AASKAAKTLAKLLSSLLKL and classifies the record as: antimicrobial. The record entered SATPdb from the yadamp database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10407EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10407 is a 23-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as ALWKDILKNAGKAALNEINQIVQ and classifies the record as: antibacterial, antimicrobial. The record entered SATPdb from the camp, yadamp database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10411EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10411 is a 6-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as SLIGRL and classifies the record as: antiviral, antimicrobial. The record entered SATPdb from the avpdb database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10413EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10413 is a 50-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as ASGRDIAMAIGTLSGQFVAGGIGAAAGGVAGGAIYDYASTHKPNPAMSPS and classifies the record as: antimicrobial. The record entered SATPdb from the yadamp database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10415EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10415 is a 10-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as AAHCLAIGRR and classifies the record as: antimicrobial. The record entered SATPdb from the yadamp database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10418EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10418 is a 35-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as GFGSLFKFLAKKVAKTVAKQAAKQGAKYVANKHME and classifies the record as: antibacterial, toxic, antimicrobial. The record entered SATPdb from the apd2, camp, hemolytik, toxinpred, yadamp database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10419EmergingOtherFact page. Full research profile pending.

SATPdb10419 is a 12-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as GPMGWVPVFYRF and classifies the record as: toxic. The record entered SATPdb from the toxinpred database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10420EmergingAntimicrobialFact page. Full research profile pending.

SATPdb10420 is a 50-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as PKRKSATKGDEPARRSARLSARPVPKPAAKPKKAAAPKKAVKGKKAAENG and classifies the record as: antimicrobial. The record entered SATPdb from the yadamp database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

SATPdb10423EmergingMetabolicFact page. Full research profile pending.

SATPdb10423 is a 5-residue peptide record held in SATPdb, a database of structurally annotated therapeutic peptides. SATPdb records its amino acid sequence as MLLCS and classifies the record as: antihypertensive. The record entered SATPdb from the ahtpdb database collection. This page lists the dataset facts for this record only. Fact page. Full research profile pending.

COA and purity data courtesy of DisclosedLabs.com - the open database for research peptide transparency. For research use only. Not for human consumption.